PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10011660m
Common NameCICLE_v10011660mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 469aa    MW: 51853.7 Da    PI: 8.5902
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10011660mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.7e-33188244360
                      -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh+k
  Ciclev10011660m 188 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSF-DGQIAEIVYKGEHNHPK 244
                      9***************************************.***************85 PP

2WRKY106.31.6e-33387444259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dg++WrKYGqK+vkg+++prsYYrCt ++C+v+k+ver+++dp+++++tYeg+Hnhe
  Ciclev10011660m 387 SDGFRWRKYGQKVVKGNPYPRSYYRCTNPKCKVRKHVERASDDPRAFITTYEGKHNHE 444
                      7********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-29184245IPR003657WRKY domain
SuperFamilySSF1182902.62E-26185245IPR003657WRKY domain
SMARTSM007743.2E-37186244IPR003657WRKY domain
PfamPF031061.1E-25188243IPR003657WRKY domain
PROSITE profilePS5081124.122188245IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-35372446IPR003657WRKY domain
SuperFamilySSF1182907.85E-29380446IPR003657WRKY domain
PROSITE profilePS5081135.152381446IPR003657WRKY domain
SMARTSM007747.7E-40386445IPR003657WRKY domain
PfamPF031061.4E-26388444IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MKIKEAERIV VAKPVPSRPT RSTFGSFSEL LEGPIHASPP NVCSETAVMA IRPKTVRFKP  60
LVNCAPPNQT ELARTAVCNS SDDVSKSDNK PTVIYKPLAR LVSKTTVSLL ENMGNFDISH  120
QHTQQSVEAQ HPSQDKQNFI SQISSNSNQV LPPLKEKDQT IESFKEASQN LEDPKYFPPV  180
AGDRPSYDGY NWRKYGQKQV KGSEYPRSYY KCTHPNCPVK KKVERSFDGQ IAEIVYKGEH  240
NHPKPQPPKR SSSVTQGLGL GSDGTGQDTN NTVWNTHLSE INEGSDGRVV NQNDLGVLAD  300
STCQAKPLPP FIPVSTGANN TDGGTSDNSC GISGEFDEGR KALEGEDEQP RKRRRSEHQS  360
NGAGLSEDSI LEPRIVVQSS TDSEILSDGF RWRKYGQKVV KGNPYPRSYY RCTNPKCKVR  420
KHVERASDDP RAFITTYEGK HNHEMPLRST TPVTSVQDSL APTSTDKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-33188446877Probable WRKY transcription factor 4
2lex_A1e-33188446877Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1350354RKRRR
2350355RKRRRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006428919.10.0hypothetical protein CICLE_v10011660mg
TrEMBLV4URL80.0V4URL8_9R
STRINGVIT_08s0040g03070.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83622740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.11e-110WRKY family protein